Lineage for d1teie_ (1tei E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1307105Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1307109Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 1307125Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (52 PDB entries)
    Uniprot P81461
  8. 1307200Domain d1teie_: 1tei E: [23983]
    complexed with ca, mn

Details for d1teie_

PDB Entry: 1tei (more details), 2.7 Å

PDB Description: structure of concanavalin a complexed to beta-d-glcnac (1,2)alpha-d- man-(1,6)[beta-d-glcnac(1,2)alpha-d-man (1,6)]alpha-d-man
PDB Compounds: (E:) concanavalin a

SCOPe Domain Sequences for d1teie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1teie_ b.29.1.1 (E:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d1teie_:

Click to download the PDB-style file with coordinates for d1teie_.
(The format of our PDB-style files is described here.)

Timeline for d1teie_: