SCOP 1.69: Domain d1teie_: 1tei E:

Lineage for d1teie_ (1tei E:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Concanavalin A [49901] (2 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (47 PDB entries)

8. Domain d1teie_: 1tei E: [23983]

Details for d1teie_

PDB Entry: 1tei, 2.7 Å

PDB Description: structure of concanavalin a complexed to beta-d-glcnac (1,2)alpha-d- man-(1,6)[beta-d-glcnac(1,2)alpha-d-man (1,6)]alpha-d-man

SCOP Domain Sequences for d1teie_:

Sequence; same for both SEQRES and ATOM records:

>d1teie_ b.29.1.1 (E:) Concanavalin A {Jack bean (Canavalia ensiformis)}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d1teie_:

• d1teie_ first appeared (with stable ids) in SCOP 1.55
  
• d1teie_ appears in SCOP 1.67
  
• d1teie_ appears in SCOP 1.71
  
• d1teie_ appears in the current release, SCOPe 2.08