Lineage for d3th4l3 (3th4 L:87-142)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1701322Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1701323Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1701750Protein automated matches [190092] (1 species)
    not a true protein
  7. 1701751Species Human (Homo sapiens) [TaxId:9606] [187310] (66 PDB entries)
  8. 1701772Domain d3th4l3: 3th4 L:87-142 [239810]
    Other proteins in same PDB: d3th4h_, d3th4l1, d3th4l2, d3th4t1, d3th4t2
    automated match to d2a2ql2
    complexed with 0ge, bgc, ca, cl, fuc, mg, na

Details for d3th4l3

PDB Entry: 3th4 (more details), 1.8 Å

PDB Description: mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+
PDB Compounds: (L:) Coagulation factor VII light chain

SCOPe Domain Sequences for d3th4l3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3th4l3 g.3.11.1 (L:87-142) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOPe Domain Coordinates for d3th4l3:

Click to download the PDB-style file with coordinates for d3th4l3.
(The format of our PDB-style files is described here.)

Timeline for d3th4l3: