| Class g: Small proteins [56992] (91 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
| Protein automated matches [226968] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225423] (21 PDB entries) |
| Domain d3th4l2: 3th4 L:49-86 [239809] Other proteins in same PDB: d3th4h_, d3th4l1, d3th4l3, d3th4t1, d3th4t2 automated match to d2a2ql1 complexed with 0ge, bgc, ca, cl, fuc, mg, na |
PDB Entry: 3th4 (more details), 1.8 Å
SCOPe Domain Sequences for d3th4l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3th4l2 g.3.11.0 (L:49-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd
Timeline for d3th4l2: