Lineage for d3th2l3 (3th2 L:87-142)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636414Protein automated matches [190092] (2 species)
    not a true protein
  7. 2636415Species Human (Homo sapiens) [TaxId:9606] [187310] (72 PDB entries)
  8. 2636433Domain d3th2l3: 3th2 L:87-142 [239807]
    Other proteins in same PDB: d3th2h_, d3th2l1, d3th2l2, d3th2t1, d3th2t2
    automated match to d2a2ql2
    complexed with ben, bgc, ca, cl, fuc, mg, na

Details for d3th2l3

PDB Entry: 3th2 (more details), 1.72 Å

PDB Description: mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+
PDB Compounds: (L:) Coagulation factor VII light chain

SCOPe Domain Sequences for d3th2l3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3th2l3 g.3.11.1 (L:87-142) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOPe Domain Coordinates for d3th2l3:

Click to download the PDB-style file with coordinates for d3th2l3.
(The format of our PDB-style files is described here.)

Timeline for d3th2l3: