SCOPe 2.07: Domain d3th2l2: 3th2 L:49-86

Lineage for d3th2l2 (3th2 L:49-86)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.0: automated matches [227227] (1 protein)
   not a true family

6. Protein automated matches [226968] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)

8. Domain d3th2l2: 3th2 L:49-86 [239806]
   Other proteins in same PDB: d3th2h_, d3th2l1, d3th2l3, d3th2t1, d3th2t2
   automated match to d2a2ql1
   complexed with ben, bgc, ca, cl, fuc, mg, na

Details for d3th2l2

PDB Entry: 3th2, 1.72 Å

PDB Description: mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+

PDB Compounds: (L:) Coagulation factor VII light chain

SCOPe Domain Sequences for d3th2l2:

Sequence; same for both SEQRES and ATOM records:

>d3th2l2 g.3.11.0 (L:49-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

Timeline for d3th2l2:

• d3th2l2 first appeared in SCOPe 2.04
  
• d3th2l2 appears in SCOPe 2.06
  
• d3th2l2 appears in the current release, SCOPe 2.08