SCOPe 2.04: Domain d3texa1: 3tex A:226-735

Lineage for d3texa1 (3tex A:226-735)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.60: Anthrax protective antigen C-terminal-like [254103] (1 superfamily)
   C-terminal 3 domains; II (226-487) is beta-sandwiches of gamma-crystallin like topology, similar to domain I; III (488-594) has a beta-grasp like fold; IV (595-735) has an Ig-like fold

4. Superfamily f.60.1: Anthrax protective antigen C-terminal-like [254122] (1 family)

5. Family f.60.1.1: Anthrax protective antigen C-terminal-like [254146] (2 proteins)

6. Protein Anthrax protective antigen C-terminal-like [254333] (1 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [254762] (14 PDB entries)

8. Domain d3texa1: 3tex A:226-735 [239799]
   Other proteins in same PDB: d3texa2
   complexed with ca

Details for d3texa1

PDB Entry: 3tex, 1.7 Å

PDB Description: Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) to 1.7-A resolution

PDB Compounds: (A:) Protective antigen

SCOPe Domain Sequences for d3texa1:

Sequence; same for both SEQRES and ATOM records:

>d3texa1 f.60.1.1 (A:226-735) Anthrax protective antigen C-terminal-like {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
wstasdpysdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsq
trtiskntstsrthtsepgsnsnsstvaidhslslagertwaetmglntadtarlnanir
yvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapialnaqd
dfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlpqiq
ettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqyqgk
ditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnniav
gadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydmlni
sslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngikkil
ifskkgyeig

Timeline for d3texa1:

• d3texa1 is new in SCOPe 2.04-stable
  
• d3texa1 appears in SCOPe 2.05
  
• d3texa1 appears in the current release, SCOPe 2.08