SCOPe 2.08: Domain d3te5c1: 3te5 C:7-186

Lineage for d3te5c1 (3te5 C:7-186)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (15 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233658] (3 PDB entries)

8. Domain d3te5c1: 3te5 C:7-186 [239795]
   Other proteins in same PDB: d3te5a_
   automated match to d3t4nc1
   complexed with nai

Details for d3te5c1

PDB Entry: 3te5, 2.5 Å

PDB Description: structure of the regulatory fragment of sacchromyces cerevisiae ampk in complex with NADH

PDB Compounds: (C:) Nuclear protein SNF4

SCOPe Domain Sequences for d3te5c1:

Sequence, based on SEQRES records:

>d3te5c1 d.37.1.0 (C:7-186) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dsqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsa
plwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdqldtas
ihpsrplfeaclkmlesrsgriplidqdeethreivvsvltqyrilkfvalncrethflk

Sequence, based on observed residues (ATOM records):

>d3te5c1 d.37.1.0 (C:7-186) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dsqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsa
plwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdtasihp
srplfeaclkmlesrsgriplidqdeethreivvsvltqyrilkfvalncrethflk

Timeline for d3te5c1:

• d3te5c1 first appeared in SCOPe 2.04
  
• d3te5c1 appears in SCOPe 2.07