Lineage for d3te5c1 (3te5 C:7-186)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167405Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2167406Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2167576Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 2167577Protein automated matches [191100] (14 species)
    not a true protein
  7. 2167592Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233658] (3 PDB entries)
  8. 2167597Domain d3te5c1: 3te5 C:7-186 [239795]
    Other proteins in same PDB: d3te5a_
    automated match to d3t4nc1
    complexed with nai

Details for d3te5c1

PDB Entry: 3te5 (more details), 2.5 Å

PDB Description: structure of the regulatory fragment of sacchromyces cerevisiae ampk in complex with NADH
PDB Compounds: (C:) Nuclear protein SNF4

SCOPe Domain Sequences for d3te5c1:

Sequence, based on SEQRES records: (download)

>d3te5c1 d.37.1.0 (C:7-186) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dsqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsa
plwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdqldtas
ihpsrplfeaclkmlesrsgriplidqdeethreivvsvltqyrilkfvalncrethflk

Sequence, based on observed residues (ATOM records): (download)

>d3te5c1 d.37.1.0 (C:7-186) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dsqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsa
plwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdtasihp
srplfeaclkmlesrsgriplidqdeethreivvsvltqyrilkfvalncrethflk

SCOPe Domain Coordinates for d3te5c1:

Click to download the PDB-style file with coordinates for d3te5c1.
(The format of our PDB-style files is described here.)

Timeline for d3te5c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3te5c2
View in 3D
Domains from other chains:
(mouse over for more information)
d3te5a_