SCOPe 2.06: Domain d3tdhc2: 3tdh C:186-321

Lineage for d3tdhc2 (3tdh C:186-321)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233658] (3 PDB entries)

8. Domain d3tdhc2: 3tdh C:186-321 [239794]
   Other proteins in same PDB: d3tdha_
   automated match to d3t4nc2
   complexed with amp

Details for d3tdhc2

PDB Entry: 3tdh, 2.3 Å

PDB Description: Structure of the regulatory fragment of sccharomyces cerevisiae AMPK in complex with AMP

PDB Compounds: (C:) Nuclear protein SNF4

SCOPe Domain Sequences for d3tdhc2:

Sequence; same for both SEQRES and ATOM records:

>d3tdhc2 d.37.1.0 (C:186-321) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ipigdlniitqdnmkscqmttpvidviqmltqgrvssvpiidengylinvyeaydvlgli
kggiyndlslsvgealmrrsddfegvytctkndklstimdnirkarvhrffvvddvgrlv
gvltlsdilkyillgs

Timeline for d3tdhc2:

• d3tdhc2 first appeared in SCOPe 2.04
  
• d3tdhc2 appears in SCOPe 2.05
  
• d3tdhc2 appears in SCOPe 2.07
  
• d3tdhc2 appears in the current release, SCOPe 2.08