| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
| Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
| Protein automated matches [191100] (15 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233658] (3 PDB entries) |
| Domain d3tdhc1: 3tdh C:6-185 [239793] Other proteins in same PDB: d3tdha_ automated match to d3t4nc1 complexed with amp |
PDB Entry: 3tdh (more details), 2.3 Å
SCOPe Domain Sequences for d3tdhc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tdhc1 d.37.1.0 (C:6-185) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dsqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsa
plwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdqldtas
ihpsrplfeaclkmlesrsgriplidqdeethreivvsvltqyrilkfvalncrethflk
Timeline for d3tdhc1: