Lineage for d3tdhc1 (3tdh C:6-185)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1645809Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1645810Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1645980Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 1645981Protein automated matches [191100] (13 species)
    not a true protein
  7. 1645996Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233658] (3 PDB entries)
  8. 1645999Domain d3tdhc1: 3tdh C:6-185 [239793]
    Other proteins in same PDB: d3tdha_
    automated match to d3t4nc1
    complexed with amp

Details for d3tdhc1

PDB Entry: 3tdh (more details), 2.3 Å

PDB Description: Structure of the regulatory fragment of sccharomyces cerevisiae AMPK in complex with AMP
PDB Compounds: (C:) Nuclear protein SNF4

SCOPe Domain Sequences for d3tdhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tdhc1 d.37.1.0 (C:6-185) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dsqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsa
plwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdqldtas
ihpsrplfeaclkmlesrsgriplidqdeethreivvsvltqyrilkfvalncrethflk

SCOPe Domain Coordinates for d3tdhc1:

Click to download the PDB-style file with coordinates for d3tdhc1.
(The format of our PDB-style files is described here.)

Timeline for d3tdhc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tdhc2
View in 3D
Domains from other chains:
(mouse over for more information)
d3tdha_