SCOPe 2.07: Domain d3t6dh1: 3t6d H:1-36

Lineage for d3t6dh1 (3t6d H:1-36)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.0: automated matches [227192] (1 protein)
   not a true family

6. Protein automated matches [226917] (6 species)
   not a true protein

7. Species Blastochloris viridis [TaxId:1079] [232250] (5 PDB entries)

8. Domain d3t6dh1: 3t6d H:1-36 [239791]
   Other proteins in same PDB: d3t6dc_, d3t6dh2, d3t6dl_, d3t6dm_
   automated match to d3g7fh1
   complexed with bcb, bpb, dga, fe2, gol, hec, hth, hto, lda, mq9, ns5, so4, uq9

Details for d3t6dh1

PDB Entry: 3t6d, 1.95 Å

PDB Description: crystal structure of the reaction centre from blastochloris viridis strain dsm 133 (atcc 19567) substrain-08

PDB Compounds: (H:) Photosynthetic reaction center H-subunit

SCOPe Domain Sequences for d3t6dh1:

Sequence; same for both SEQRES and ATOM records:

>d3t6dh1 f.23.10.0 (H:1-36) automated matches {Blastochloris viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

Timeline for d3t6dh1:

• d3t6dh1 first appeared in SCOPe 2.04
  
• d3t6dh1 appears in SCOPe 2.06
  
• d3t6dh1 appears in the current release, SCOPe 2.08