Lineage for d1enqc_ (1enq C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042202Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 2042222Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (58 PDB entries)
    Uniprot P81461
  8. 2042299Domain d1enqc_: 1enq C: [23977]
    complexed with zn

Details for d1enqc_

PDB Entry: 1enq (more details), 2.5 Å

PDB Description: co-crystals of demetallized concanavalin a with zinc having a zinc ion bound in the s1 site
PDB Compounds: (C:) concanavalin a

SCOPe Domain Sequences for d1enqc_:

Sequence, based on SEQRES records: (download)

>d1enqc_ b.29.1.1 (C:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d1enqc_ b.29.1.1 (C:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvsgssvgralfyapvhiwessa
vvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d1enqc_:

Click to download the PDB-style file with coordinates for d1enqc_.
(The format of our PDB-style files is described here.)

Timeline for d1enqc_: