Lineage for d3sr6j1 (3sr6 J:2-92)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1894211Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 1894368Protein automated matches [231466] (4 species)
    not a true protein
  7. 1894369Species Cow (Bos taurus) [TaxId:9913] [232069] (9 PDB entries)
  8. 1894379Domain d3sr6j1: 3sr6 J:2-92 [239755]
    Other proteins in same PDB: d3sr6a2, d3sr6b1, d3sr6b2, d3sr6c1, d3sr6c2, d3sr6j2, d3sr6k1, d3sr6k2, d3sr6l1, d3sr6l2
    automated match to d3etrl1
    complexed with fad, fes, mte, rmo

Details for d3sr6j1

PDB Entry: 3sr6 (more details), 2.1 Å

PDB Description: Crystal Structure of Reduced Bovine Xanthine Oxidase in Complex with Arsenite
PDB Compounds: (J:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3sr6j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sr6j1 d.15.4.2 (J:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d3sr6j1:

Click to download the PDB-style file with coordinates for d3sr6j1.
(The format of our PDB-style files is described here.)

Timeline for d3sr6j1: