Lineage for d3sdld1 (3sdl D:4-78)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540283Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries)
  8. 2540409Domain d3sdld1: 3sdl D:4-78 [239726]
    Other proteins in same PDB: d3sdla_, d3sdlb_, d3sdlc2, d3sdld2
    automated match to d3r66c1

Details for d3sdld1

PDB Entry: 3sdl (more details), 2.29 Å

PDB Description: crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2
PDB Compounds: (D:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d3sdld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdld1 d.15.1.0 (D:4-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq
glgpgstvllvvdkc

SCOPe Domain Coordinates for d3sdld1:

Click to download the PDB-style file with coordinates for d3sdld1.
(The format of our PDB-style files is described here.)

Timeline for d3sdld1: