![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (10 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187090] (41 PDB entries) |
![]() | Domain d3sdld1: 3sdl D:4-78 [239726] Other proteins in same PDB: d3sdla_, d3sdlb_, d3sdlc2, d3sdld2 automated match to d3r66c1 |
PDB Entry: 3sdl (more details), 2.29 Å
SCOPe Domain Sequences for d3sdld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sdld1 d.15.1.0 (D:4-78) automated matches {Human (Homo sapiens) [TaxId: 9606]} dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq glgpgstvllvvdkc
Timeline for d3sdld1:
![]() Domains from other chains: (mouse over for more information) d3sdla_, d3sdlb_, d3sdlc1, d3sdlc2 |