SCOPe 2.08: Domain d3sdld1: 3sdl D:4-78

Lineage for d3sdld1 (3sdl D:4-78)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)

8. Domain d3sdld1: 3sdl D:4-78 [239726]
   Other proteins in same PDB: d3sdla_, d3sdlb_, d3sdlc2, d3sdld2
   automated match to d3r66c1

Details for d3sdld1

PDB Entry: 3sdl, 2.29 Å

PDB Description: crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2

PDB Compounds: (D:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d3sdld1:

Sequence; same for both SEQRES and ATOM records:

>d3sdld1 d.15.1.0 (D:4-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq
glgpgstvllvvdkc

Timeline for d3sdld1:

• d3sdld1 first appeared in SCOPe 2.04
  
• d3sdld1 appears in SCOPe 2.07