![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (10 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189560] (70 PDB entries) |
![]() | Domain d3sdlc2: 3sdl C:79-154 [239725] Other proteins in same PDB: d3sdla_, d3sdlb_, d3sdlc1, d3sdld1 automated match to d3r66c2 |
PDB Entry: 3sdl (more details), 2.29 Å
SCOPe Domain Sequences for d3sdlc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sdlc2 d.15.1.1 (C:79-154) automated matches {Human (Homo sapiens) [TaxId: 9606]} deplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplg eyglkplstvfmnlrl
Timeline for d3sdlc2:
![]() Domains from other chains: (mouse over for more information) d3sdla_, d3sdlb_, d3sdld1, d3sdld2 |