Lineage for d3sdkb_ (3sdk B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2228747Domain d3sdkb_: 3sdk B: [239720]
    Other proteins in same PDB: d3sdk1_, d3sdk2_, d3sdka_, d3sdkc_, d3sdke_, d3sdkf_, d3sdkg_, d3sdkh_, d3sdki_, d3sdkj_, d3sdkk_, d3sdkl_, d3sdkm_, d3sdkn_, d3sdko_, d3sdkq_, d3sdks_, d3sdkt_, d3sdku_, d3sdkv_, d3sdkw_, d3sdkx_, d3sdky_, d3sdkz_
    automated match to d3oeub_
    complexed with mes, mg, p3n

Details for d3sdkb_

PDB Entry: 3sdk (more details), 2.7 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 34
PDB Compounds: (B:) Proteasome component Y13

SCOPe Domain Sequences for d3sdkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdkb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtsteklykln
dkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqhgglrp
fgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmkvddai
elalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgit

SCOPe Domain Coordinates for d3sdkb_:

Click to download the PDB-style file with coordinates for d3sdkb_.
(The format of our PDB-style files is described here.)

Timeline for d3sdkb_: