Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (27 species) not a true protein |
Species Influenza A virus [TaxId:11320] [255822] (11 PDB entries) |
Domain d3s11f_: 3s11 F: [239710] Other proteins in same PDB: d3s11a_, d3s11c_, d3s11e_ automated match to d4n5zb_ complexed with gol, nag, tam |
PDB Entry: 3s11 (more details), 2.5 Å
SCOPe Domain Sequences for d3s11f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s11f_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei
Timeline for d3s11f_: