SCOPe 2.04: Domain d3s11f_: 3s11 F:

Lineage for d3s11f_ (3s11 F:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (27 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [255822] (11 PDB entries)

8. Domain d3s11f_: 3s11 F: [239710]
   Other proteins in same PDB: d3s11a_, d3s11c_, d3s11e_
   automated match to d4n5zb_
   complexed with gol, nag, tam

Details for d3s11f_

PDB Entry: 3s11, 2.5 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, strain 437-10

PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d3s11f_:

Sequence; same for both SEQRES and ATOM records:

>d3s11f_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei

Timeline for d3s11f_:

• d3s11f_ is new in SCOPe 2.04-stable
  
• d3s11f_ appears in SCOPe 2.05
  
• d3s11f_ appears in the current release, SCOPe 2.08