SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3rtld1 (3rtl D:341-456)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2033450Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2033496Family b.1.28.0: automated matches [195425] (1 protein)
    not a true family
  6. 2033497Protein automated matches [195426] (6 species)
    not a true protein
  7. 2033512Species Staphylococcus aureus [TaxId:158879] [233500] (7 PDB entries)
  8. 2033516Domain d3rtld1: 3rtl D:341-456 [239706]
    Other proteins in same PDB: d3rtla2, d3rtlb2, d3rtlc2, d3rtld2
    automated match to d3rtlb_
    complexed with cl, hem, mg

Details for d3rtld1

PDB Entry: 3rtl (more details), 1.45 Å

PDB Description: Staphylococcus aureus heme-bound IsdB-N2
PDB Compounds: (D:) Iron-regulated surface determinant protein B

SCOPe Domain Sequences for d3rtld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rtld1 b.1.28.0 (D:341-456) automated matches {Staphylococcus aureus [TaxId: 158879]}
kmtdlqdtkyvvyesvennesmmdtfvkhpiktgmlngkkymvmettnddywkdfmvegq
rvrtiskdaknntrtiifpyvegktlydaivkvhvktidydgqyhvrivdkeaftk

SCOPe Domain Coordinates for d3rtld1:

Click to download the PDB-style file with coordinates for d3rtld1.
(The format of our PDB-style files is described here.)

Timeline for d3rtld1: