Lineage for d3rtlc1 (3rtl C:341-458)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376607Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2376653Family b.1.28.0: automated matches [195425] (1 protein)
    not a true family
  6. 2376654Protein automated matches [195426] (7 species)
    not a true protein
  7. 2376673Species Staphylococcus aureus [TaxId:158879] [233500] (8 PDB entries)
  8. 2376676Domain d3rtlc1: 3rtl C:341-458 [239705]
    Other proteins in same PDB: d3rtla2, d3rtlb2, d3rtlc2, d3rtld2
    automated match to d3rtlb_
    complexed with cl, hem, mg

Details for d3rtlc1

PDB Entry: 3rtl (more details), 1.45 Å

PDB Description: staphylococcus aureus heme-bound isdb-n2
PDB Compounds: (C:) Iron-regulated surface determinant protein B

SCOPe Domain Sequences for d3rtlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rtlc1 b.1.28.0 (C:341-458) automated matches {Staphylococcus aureus [TaxId: 158879]}
kmtdlqdtkyvvyesvennesmmdtfvkhpiktgmlngkkymvmettnddywkdfmvegq
rvrtiskdaknntrtiifpyvegktlydaivkvhvktidydgqyhvrivdkeaftkan

SCOPe Domain Coordinates for d3rtlc1:

Click to download the PDB-style file with coordinates for d3rtlc1.
(The format of our PDB-style files is described here.)

Timeline for d3rtlc1: