SCOPe 2.04: Domain d3rtjb1: 3rtj B:1-135

Lineage for d3rtjb1 (3rtj B:1-135)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (8 species)
   not a true protein

7. Species Castor bean (Ricinus communis) [TaxId:3988] [256065] (1 PDB entry)

8. Domain d3rtjb1: 3rtj B:1-135 [239703]
   Other proteins in same PDB: d3rtja_
   automated match to d1hwob1
   protein/RNA complex

Details for d3rtjb1

PDB Entry: 3rtj, 3 Å

PDB Description: crystal structure of ricin bound with dinucleotide apg

PDB Compounds: (B:) Ricin B chain

SCOPe Domain Sequences for d3rtjb1:

Sequence; same for both SEQRES and ATOM records:

>d3rtjb1 b.42.2.0 (B:1-135) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
advcmdpepivrivgrnglcvdvrdgrfhngnaiqlwpcksntdanqlwtlkrdntirsn
gkclttygyspgvyvmiydcntaatdatrwqiwdngtiinprsslvlaatsgnsgttltv
qtniyavsqgwlptn

Timeline for d3rtjb1:

• d3rtjb1 is new in SCOPe 2.04-stable
  
• d3rtjb1 appears in SCOPe 2.05
  
• d3rtjb1 appears in the current release, SCOPe 2.08