![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries) |
![]() | Domain d3rsjc1: 3rsj C:868-1085 [239699] Other proteins in same PDB: d3rsja2, d3rsjb2, d3rsjc2, d3rsjd2 automated match to d3rsja1 |
PDB Entry: 3rsj (more details), 2 Å
SCOPe Domain Sequences for d3rsjc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rsjc1 b.29.1.0 (C:868-1085) automated matches {Clostridium botulinum [TaxId: 1491]} dnsildmryennkfidisgygsnisingdvyiystnrnqfgiysskpsevniaqnndiiy ngryqnfsisfwvripkyfnkvnlnneytiidcirnnnsgwkislnynkiiwtlqdtagn nqklvfnytqmisisdyinkwifvtitnnrlgnsriyingnlideksisnlgdihvsdni lfkivgcndtryvgiryfkvfdtelgkteietlysdep
Timeline for d3rsjc1: