Lineage for d3rsjc1 (3rsj C:868-1085)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780769Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)
  8. 2780779Domain d3rsjc1: 3rsj C:868-1085 [239699]
    Other proteins in same PDB: d3rsja2, d3rsjb2, d3rsjc2, d3rsjd2
    automated match to d3rsja1

Details for d3rsjc1

PDB Entry: 3rsj (more details), 2 Å

PDB Description: structure of hcrf in complex with ganglioside gd1a
PDB Compounds: (C:) BoNT/F

SCOPe Domain Sequences for d3rsjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rsjc1 b.29.1.0 (C:868-1085) automated matches {Clostridium botulinum [TaxId: 1491]}
dnsildmryennkfidisgygsnisingdvyiystnrnqfgiysskpsevniaqnndiiy
ngryqnfsisfwvripkyfnkvnlnneytiidcirnnnsgwkislnynkiiwtlqdtagn
nqklvfnytqmisisdyinkwifvtitnnrlgnsriyingnlideksisnlgdihvsdni
lfkivgcndtryvgiryfkvfdtelgkteietlysdep

SCOPe Domain Coordinates for d3rsjc1:

Click to download the PDB-style file with coordinates for d3rsjc1.
(The format of our PDB-style files is described here.)

Timeline for d3rsjc1: