SCOPe 2.08: Domain d3rsjc1: 3rsj C:868-1085

Lineage for d3rsjc1 (3rsj C:868-1085)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)

8. Domain d3rsjc1: 3rsj C:868-1085 [239699]
   Other proteins in same PDB: d3rsja2, d3rsjb2, d3rsjc2, d3rsjd2
   automated match to d3rsja1

Details for d3rsjc1

PDB Entry: 3rsj, 2 Å

PDB Description: structure of hcrf in complex with ganglioside gd1a

PDB Compounds: (C:) BoNT/F

SCOPe Domain Sequences for d3rsjc1:

Sequence; same for both SEQRES and ATOM records:

>d3rsjc1 b.29.1.0 (C:868-1085) automated matches {Clostridium botulinum [TaxId: 1491]}
dnsildmryennkfidisgygsnisingdvyiystnrnqfgiysskpsevniaqnndiiy
ngryqnfsisfwvripkyfnkvnlnneytiidcirnnnsgwkislnynkiiwtlqdtagn
nqklvfnytqmisisdyinkwifvtitnnrlgnsriyingnlideksisnlgdihvsdni
lfkivgcndtryvgiryfkvfdtelgkteietlysdep

Timeline for d3rsjc1:

• d3rsjc1 first appeared in SCOPe 2.04
  
• d3rsjc1 appears in SCOPe 2.07