SCOPe 2.08: Domain d3r95b_: 3r95 B:

Lineage for d3r95b_ (3r95 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [233422] (5 PDB entries)

8. Domain d3r95b_: 3r95 B: [239690]
   automated match to d3r95a_
   complexed with aco

Details for d3r95b_

PDB Entry: 3r95, 1.6 Å

PDB Description: crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa

PDB Compounds: (B:) MccE protein

SCOPe Domain Sequences for d3r95b_:

Sequence; same for both SEQRES and ATOM records:

>d3r95b_ d.108.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
psgikvndeitllypalkyaeelyllinqnkinfiksmawpafvnnisdsvsfieqsmid
nqnekalilfikyktkiagvvsfniidhanktayigywlganfqgkgivtnainkliqey
gdsgvikrfvikcivdnkksnatalrcgftlegvlqkaeilngvsydqniyskvi

Timeline for d3r95b_:

• d3r95b_ first appeared in SCOPe 2.04
  
• d3r95b_ appears in SCOPe 2.07