Lineage for d1vlng_ (1vln G:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 294478Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 294482Protein Concanavalin A [49901] (2 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond,whereas the "new" ones correspond to a cleaved loop
  7. 294488Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (45 PDB entries)
  8. 294537Domain d1vlng_: 1vln G: [23969]

Details for d1vlng_

PDB Entry: 1vln (more details), 2.4 Å

PDB Description: a triclinic crystal form of the lectin concanavalin a

SCOP Domain Sequences for d1vlng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlng_ b.29.1.1 (G:) Concanavalin A {Jack bean (Canavalia ensiformis)}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOP Domain Coordinates for d1vlng_:

Click to download the PDB-style file with coordinates for d1vlng_.
(The format of our PDB-style files is described here.)

Timeline for d1vlng_: