Lineage for d3r64b_ (3r64 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141240Species Corynebacterium glutamicum [TaxId:196627] [233407] (1 PDB entry)
  8. 2141242Domain d3r64b_: 3r64 B: [239687]
    Other proteins in same PDB: d3r64a2
    automated match to d3r64a_

Details for d3r64b_

PDB Entry: 3r64 (more details), 2.57 Å

PDB Description: Crystal structure of a NAD-dependent benzaldehyde dehydrogenase from Corynebacterium glutamicum
PDB Compounds: (B:) NAD dependent benzaldehyde dehydrogenase

SCOPe Domain Sequences for d3r64b_:

Sequence, based on SEQRES records: (download)

>d3r64b_ c.82.1.0 (B:) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
tfagidatkhliggqwvegnsdristninpyddsviaeskqasiadvdaayeaakkaqae
waatpaaersaiiyraaelleehreeivewlikesgstrskanleitlagnitkesasfp
grvhgrispsntpgkenrvyrvakgvvgvispwnfplnlsirsvapalavgnavvikpas
dtpvtggviparifeeagvpagvistvagagseigdhfvthavpklisftgstpvgrrvg
elainggpmktvalelggnapfvvladadidaaaqaaavgaflhqgqicmsinrvivdaa
vhdeflekfveavkniptgdpsaegtlvgpvindsqlsglkekielakkegatvqvegpi
egrlvhphvfsdvtsdmeiareeifgplisvlkaddeahaaelanasdfglsaavwskdi
draaqfalqidsgmvhindltvndephvmfggsknsglgrfngdwaieefttdrwigikr

Sequence, based on observed residues (ATOM records): (download)

>d3r64b_ c.82.1.0 (B:) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
tfagidatkhliggqwvegnsdristninpyddsviaeskqasiadvdaayeaakkaqae
waatpaaersaiiyraaelleehreeivewlikesgstrskanleitlagnitkesasfp
grvhgrispsntpgkenrvyrvakgvvgvispwnfplnlsirsvapalavgnavvikpas
dtpvtggviparifeeagvpagvistvagagseigdhfvthavpklisftgstpvgrrvg
elainggpmktvalelggnapfvvladadidaaaqaaavgaflhqgqicmsinrvivdaa
vhdeflekfveavkniptgdpsagtlvgpvindsqlsglkekielakkegatvqvegpie
grlvhphvfsdvtsdmeiareeifgplisvlkaddeahaaelanasdfglsaavwskdid
raaqfalqidsgmvhindrfngdwaieefttdrwigikr

SCOPe Domain Coordinates for d3r64b_:

Click to download the PDB-style file with coordinates for d3r64b_.
(The format of our PDB-style files is described here.)

Timeline for d3r64b_: