![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins) |
![]() | Protein D-Ala-D-Ala ligase, N-domain [52453] (3 species) |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [256401] (1 PDB entry) |
![]() | Domain d3r5xc2: 3r5x C:1-93 [239685] Other proteins in same PDB: d3r5xa1, d3r5xa3, d3r5xb1, d3r5xb3, d3r5xc1, d3r5xc3, d3r5xd1, d3r5xd3 complexed with acy, atp, ca, edo, mg |
PDB Entry: 3r5x (more details), 2 Å
SCOPe Domain Sequences for d3r5xc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r5xc2 c.30.1.2 (C:1-93) D-Ala-D-Ala ligase, N-domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mrigvimggvssekqvsimtgnemianldknkyeivpitlnekmdliekakdidfallal hgkygedgtvqgtleslgipysgsnmlssgicm
Timeline for d3r5xc2: