Lineage for d3r4ub1 (3r4u B:864-1093)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1534620Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1534621Protein automated matches [190437] (29 species)
    not a true protein
  7. 1534690Species Clostridium botulinum [TaxId:1491] [225675] (19 PDB entries)
  8. 1534699Domain d3r4ub1: 3r4u B:864-1093 [239681]
    Other proteins in same PDB: d3r4ua2, d3r4ub2
    automated match to d3r4sb1

Details for d3r4ub1

PDB Entry: 3r4u (more details), 2.2 Å

PDB Description: cell entry of botulinum neurotoxin type c is dependent upon interaction with two ganglioside molecules
PDB Compounds: (B:) Botulinum neurotoxin type C1

SCOPe Domain Sequences for d3r4ub1:

Sequence, based on SEQRES records: (download)

>d3r4ub1 b.29.1.0 (B:864-1093) automated matches {Clostridium botulinum [TaxId: 1491]}
smanindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkviv
tqnenivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkq
nedseqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfs
ktitfeinkipdtglitsdsdninmwirdfyifakeldgkdinilfnslq

Sequence, based on observed residues (ATOM records): (download)

>d3r4ub1 b.29.1.0 (B:864-1093) automated matches {Clostridium botulinum [TaxId: 1491]}
smanindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkviv
tqnenivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkq
nedseqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfs
ktitfeinkipdtsdninmwirdfyifakeldgkdinilfnslq

SCOPe Domain Coordinates for d3r4ub1:

Click to download the PDB-style file with coordinates for d3r4ub1.
(The format of our PDB-style files is described here.)

Timeline for d3r4ub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r4ub2