SCOPe 2.06: Domain d3r23a2: 3r23 A:1-93

Lineage for d3r23a2 (3r23 A:1-93)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins)

6. Protein D-Ala-D-Ala ligase, N-domain [52453] (3 species)

7. Species Bacillus anthracis [TaxId:198094] [256400] (1 PDB entry)

8. Domain d3r23a2: 3r23 A:1-93 [239678]
   Other proteins in same PDB: d3r23a1, d3r23a3, d3r23b1, d3r23b3
   complexed with edo

Details for d3r23a2

PDB Entry: 3r23, 2.5 Å

PDB Description: Crystal Structure of D-alanine--D-Alanine Ligase from Bacillus anthracis

PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3r23a2:

Sequence; same for both SEQRES and ATOM records:

>d3r23a2 c.30.1.2 (A:1-93) D-Ala-D-Ala ligase, N-domain {Bacillus anthracis [TaxId: 198094]}
mrigvimggvssekqvsimtgnemianldknkyeivpitlnekmdliekakdidfallal
hgkygedgtvqgtleslgipysgsnmlssgicm

Timeline for d3r23a2:

• d3r23a2 first appeared in SCOPe 2.04
  
• d3r23a2 appears in SCOPe 2.05
  
• d3r23a2 appears in SCOPe 2.07
  
• d3r23a2 appears in the current release, SCOPe 2.08