| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins) |
| Protein D-Ala-D-Ala ligase, N-domain [52453] (3 species) |
| Species Bacillus anthracis [TaxId:198094] [256400] (1 PDB entry) |
| Domain d3r23a2: 3r23 A:1-93 [239678] Other proteins in same PDB: d3r23a1, d3r23a3, d3r23b1, d3r23b3 complexed with edo |
PDB Entry: 3r23 (more details), 2.5 Å
SCOPe Domain Sequences for d3r23a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r23a2 c.30.1.2 (A:1-93) D-Ala-D-Ala ligase, N-domain {Bacillus anthracis [TaxId: 198094]}
mrigvimggvssekqvsimtgnemianldknkyeivpitlnekmdliekakdidfallal
hgkygedgtvqgtleslgipysgsnmlssgicm
Timeline for d3r23a2: