Lineage for d3qz9g_ (3qz9 G:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548277Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2548278Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2548279Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2548299Protein automated matches [190256] (6 species)
    not a true protein
  7. 2548306Species Pseudomonas putida [TaxId:303] [226093] (5 PDB entries)
  8. 2548322Domain d3qz9g_: 3qz9 G: [239671]
    Other proteins in same PDB: d3qz9b_, d3qz9d_, d3qz9f_, d3qz9h_
    automated match to d3qxea_
    complexed with 3co, gol

Details for d3qz9g_

PDB Entry: 3qz9 (more details), 2.4 Å

PDB Description: crystal structure of co-type nitrile hydratase beta-y215f from pseudomonas putida.
PDB Compounds: (G:) Co-type Nitrile Hydratase alpha subunit

SCOPe Domain Sequences for d3qz9g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qz9g_ d.149.1.1 (G:) automated matches {Pseudomonas putida [TaxId: 303]}
dhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvakaw
vdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglpp
awykaapyrsrmvsdprgvlaefglvipankeirvwdttaelrymvlperpagteaysee
qlaelvtrdsmigtglptqp

SCOPe Domain Coordinates for d3qz9g_:

Click to download the PDB-style file with coordinates for d3qz9g_.
(The format of our PDB-style files is described here.)

Timeline for d3qz9g_: