Lineage for d3qz9c_ (3qz9 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224127Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2224128Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2224129Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2224149Protein automated matches [190256] (6 species)
    not a true protein
  7. 2224156Species Pseudomonas putida [TaxId:303] [226093] (5 PDB entries)
  8. 2224170Domain d3qz9c_: 3qz9 C: [239669]
    Other proteins in same PDB: d3qz9b_, d3qz9d_, d3qz9f_, d3qz9h_
    automated match to d3qxea_
    complexed with 3co, gol

Details for d3qz9c_

PDB Entry: 3qz9 (more details), 2.4 Å

PDB Description: crystal structure of co-type nitrile hydratase beta-y215f from pseudomonas putida.
PDB Compounds: (C:) Co-type Nitrile Hydratase alpha subunit

SCOPe Domain Sequences for d3qz9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qz9c_ d.149.1.1 (C:) automated matches {Pseudomonas putida [TaxId: 303]}
hdhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvaka
wvdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglp
pawykaapyrsrmvsdprgvlaefglvipankeirvwdttaelrymvlperpagteayse
eqlaelvtrdsmigtglptqp

SCOPe Domain Coordinates for d3qz9c_:

Click to download the PDB-style file with coordinates for d3qz9c_.
(The format of our PDB-style files is described here.)

Timeline for d3qz9c_: