| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily) 4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets |
Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) ![]() duplication: contains two structural repeats |
| Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins) automatically mapped to Pfam PF02979 |
| Protein automated matches [190256] (6 species) not a true protein |
| Species Pseudomonas putida [TaxId:303] [226093] (5 PDB entries) |
| Domain d3qz9c_: 3qz9 C: [239669] Other proteins in same PDB: d3qz9b_, d3qz9d_, d3qz9f_, d3qz9h_ automated match to d3qxea_ complexed with 3co, gol |
PDB Entry: 3qz9 (more details), 2.4 Å
SCOPe Domain Sequences for d3qz9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qz9c_ d.149.1.1 (C:) automated matches {Pseudomonas putida [TaxId: 303]}
hdhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvaka
wvdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglp
pawykaapyrsrmvsdprgvlaefglvipankeirvwdttaelrymvlperpagteayse
eqlaelvtrdsmigtglptqp
Timeline for d3qz9c_: