Lineage for d3qyhg_ (3qyh G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934013Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 1934014Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 1934015Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 1934035Protein automated matches [190256] (6 species)
    not a true protein
  7. 1934042Species Pseudomonas putida [TaxId:303] [226093] (5 PDB entries)
  8. 1934046Domain d3qyhg_: 3qyh G: [239667]
    Other proteins in same PDB: d3qyhb_, d3qyhd_, d3qyhf_, d3qyhh_
    automated match to d3qxea_
    complexed with 3co

Details for d3qyhg_

PDB Entry: 3qyh (more details), 2 Å

PDB Description: crystal structure of co-type nitrile hydratase beta-h71l from pseudomonas putida.
PDB Compounds: (G:) Co-type Nitrile Hydratase alpha subunit

SCOPe Domain Sequences for d3qyhg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qyhg_ d.149.1.1 (G:) automated matches {Pseudomonas putida [TaxId: 303]}
dhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvakaw
vdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglpp
awykaapyrsrmvsdprgvlaefglvipankeirvwdttaelrymvlperpagteaysee
qlaelvtrdsmigtglptqp

SCOPe Domain Coordinates for d3qyhg_:

Click to download the PDB-style file with coordinates for d3qyhg_.
(The format of our PDB-style files is described here.)

Timeline for d3qyhg_: