Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily) 4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets |
Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) duplication: contains two structural repeats |
Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins) automatically mapped to Pfam PF02979 |
Protein automated matches [190256] (6 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [226093] (5 PDB entries) |
Domain d3qxec_: 3qxe C: [239657] Other proteins in same PDB: d3qxeb_, d3qxed_, d3qxef_, d3qxeh_ automated match to d3qxea_ complexed with 3co, gol |
PDB Entry: 3qxe (more details), 2.1 Å
SCOPe Domain Sequences for d3qxec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qxec_ d.149.1.1 (C:) automated matches {Pseudomonas putida [TaxId: 303]} hdhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvaka wvdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglp pawykaapyrsrmvsdprgvlaefglvipankeirvwdttaelrymvlperpagteayse eqlaelvtrdsmigtglptqp
Timeline for d3qxec_: