Lineage for d3qqof_ (3qqo F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041617Species Influenza A virus [TaxId:387161] [255913] (6 PDB entries)
  8. 3041625Domain d3qqof_: 3qqo F: [239650]
    Other proteins in same PDB: d3qqoa1, d3qqoa2, d3qqoc1, d3qqoc2, d3qqoe1, d3qqoe2
    automated match to d1qfub_
    complexed with nag; mutant

Details for d3qqof_

PDB Entry: 3qqo (more details), 2.9 Å

PDB Description: crystal structure of ha2 r106h mutant of h2 hemagglutinin, acidic ph form
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d3qqof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qqof_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 387161]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenehtldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne

SCOPe Domain Coordinates for d3qqof_:

Click to download the PDB-style file with coordinates for d3qqof_.
(The format of our PDB-style files is described here.)

Timeline for d3qqof_: