SCOPe 2.05: Domain d3qqod_: 3qqo D:

Lineage for d3qqod_ (3qqo D:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza A virus [TaxId:387161] [255913] (6 PDB entries)

8. Domain d3qqod_: 3qqo D: [239649]
   Other proteins in same PDB: d3qqoa_, d3qqoc_, d3qqoe_
   automated match to d1qfub_
   complexed with nag; mutant

Details for d3qqod_

PDB Entry: 3qqo, 2.9 Å

PDB Description: crystal structure of ha2 r106h mutant of h2 hemagglutinin, acidic ph form

PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d3qqod_:

Sequence; same for both SEQRES and ATOM records:

>d3qqod_ h.3.1.1 (D:) automated matches {Influenza A virus [TaxId: 387161]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenehtldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne

Timeline for d3qqod_:

• d3qqod_ first appeared in SCOPe 2.04
  
• d3qqod_ appears in SCOPe 2.06
  
• d3qqod_ appears in the current release, SCOPe 2.08