![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein automated matches [254646] (29 species) not a true protein |
![]() | Species Influenza A virus [TaxId:387161] [255913] (6 PDB entries) |
![]() | Domain d3qqod_: 3qqo D: [239649] Other proteins in same PDB: d3qqoa1, d3qqoa2, d3qqoc1, d3qqoc2, d3qqoe1, d3qqoe2 automated match to d1qfub_ complexed with nag; mutant |
PDB Entry: 3qqo (more details), 2.9 Å
SCOPe Domain Sequences for d3qqod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qqod_ h.3.1.1 (D:) automated matches {Influenza A virus [TaxId: 387161]} glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenehtldfhdsnvknlyd kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne
Timeline for d3qqod_: