Lineage for d3qqob_ (3qqo B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970146Species Influenza A virus [TaxId:387161] [255913] (6 PDB entries)
  8. 1970152Domain d3qqob_: 3qqo B: [239648]
    Other proteins in same PDB: d3qqoa_, d3qqoc_, d3qqoe_
    automated match to d1qfub_
    complexed with nag; mutant

Details for d3qqob_

PDB Entry: 3qqo (more details), 2.9 Å

PDB Description: crystal structure of ha2 r106h mutant of h2 hemagglutinin, acidic ph form
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d3qqob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qqob_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 387161]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenehtldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne

SCOPe Domain Coordinates for d3qqob_:

Click to download the PDB-style file with coordinates for d3qqob_.
(The format of our PDB-style files is described here.)

Timeline for d3qqob_: