Lineage for d3qqeb_ (3qqe B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970146Species Influenza A virus [TaxId:387161] [255913] (6 PDB entries)
  8. 1970151Domain d3qqeb_: 3qqe B: [239647]
    Other proteins in same PDB: d3qqea_
    automated match to d1qfub_
    complexed with edo, nag, peg; mutant

Details for d3qqeb_

PDB Entry: 3qqe (more details), 2.1 Å

PDB Description: crystal structure of ha2 r106h mutant of h2 hemagglutinin, re- neutralized form
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d3qqeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qqeb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 387161]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenehtldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne

SCOPe Domain Coordinates for d3qqeb_:

Click to download the PDB-style file with coordinates for d3qqeb_.
(The format of our PDB-style files is described here.)

Timeline for d3qqeb_: