SCOPe 2.08: Domain d3qqeb_: 3qqe B:

Lineage for d3qqeb_ (3qqe B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (29 species)
   not a true protein

7. Species Influenza A virus [TaxId:387161] [255913] (6 PDB entries)

8. Domain d3qqeb_: 3qqe B: [239647]
   Other proteins in same PDB: d3qqea1, d3qqea2
   automated match to d1qfub_
   complexed with edo, nag, peg; mutant

Details for d3qqeb_

PDB Entry: 3qqe, 2.1 Å

PDB Description: crystal structure of ha2 r106h mutant of h2 hemagglutinin, re- neutralized form

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d3qqeb_:

Sequence; same for both SEQRES and ATOM records:

>d3qqeb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 387161]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenehtldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne

Timeline for d3qqeb_:

• d3qqeb_ first appeared in SCOPe 2.04
  
• d3qqeb_ appears in SCOPe 2.07