Lineage for d3qq8a2 (3qq8 A:107-186)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549324Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549325Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2549326Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)
  6. 2549341Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)
  7. 2549342Species Human (Homo sapiens) [TaxId:9606] [233318] (13 PDB entries)
  8. 2549343Domain d3qq8a2: 3qq8 A:107-186 [239645]
    Other proteins in same PDB: d3qq8a1, d3qq8b_
    automated match to d3qq7a2
    complexed with cl

Details for d3qq8a2

PDB Entry: 3qq8 (more details), 2 Å

PDB Description: Crystal structure of p97-N in complex with FAF1-UBX
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3qq8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qq8a2 d.31.1.1 (A:107-186) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihceg

SCOPe Domain Coordinates for d3qq8a2:

Click to download the PDB-style file with coordinates for d3qq8a2.
(The format of our PDB-style files is described here.)

Timeline for d3qq8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qq8a1
View in 3D
Domains from other chains:
(mouse over for more information)
d3qq8b_