SCOPe 2.04: Domain d3qq8a2: 3qq8 A:107-186

Lineage for d3qq8a2 (3qq8 A:107-186)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families)

5. Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)

6. Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [233318] (5 PDB entries)

8. Domain d3qq8a2: 3qq8 A:107-186 [239645]
   Other proteins in same PDB: d3qq8a1, d3qq8b_
   automated match to d3qq7a2
   complexed with cl

Details for d3qq8a2

PDB Entry: 3qq8, 2 Å

PDB Description: Crystal structure of p97-N in complex with FAF1-UBX

PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3qq8a2:

Sequence; same for both SEQRES and ATOM records:

>d3qq8a2 d.31.1.1 (A:107-186) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihceg

Timeline for d3qq8a2:

• d3qq8a2 is new in SCOPe 2.04-stable
  
• d3qq8a2 appears in SCOPe 2.05
  
• d3qq8a2 appears in the current release, SCOPe 2.08