Lineage for d3qq8a1 (3qq8 A:10-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412093Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2412166Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2412311Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins)
  6. 2412312Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (2 species)
  7. 2412313Species Human (Homo sapiens) [TaxId:9606] [233316] (13 PDB entries)
  8. 2412314Domain d3qq8a1: 3qq8 A:10-106 [239644]
    Other proteins in same PDB: d3qq8a2, d3qq8b_
    automated match to d3qq7a1
    complexed with cl

Details for d3qq8a1

PDB Entry: 3qq8 (more details), 2 Å

PDB Description: Crystal structure of p97-N in complex with FAF1-UBX
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3qq8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qq8a1 b.52.2.3 (A:10-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Human (Homo sapiens) [TaxId: 9606]}
ddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavc
ivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d3qq8a1:

Click to download the PDB-style file with coordinates for d3qq8a1.
(The format of our PDB-style files is described here.)

Timeline for d3qq8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qq8a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3qq8b_