| Class b: All beta proteins [48724] (178 folds) |
| Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
| Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins) |
| Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [233316] (13 PDB entries) |
| Domain d3qq8a1: 3qq8 A:10-106 [239644] Other proteins in same PDB: d3qq8a2, d3qq8b_ automated match to d3qq7a1 complexed with cl |
PDB Entry: 3qq8 (more details), 2 Å
SCOPe Domain Sequences for d3qq8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qq8a1 b.52.2.3 (A:10-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Human (Homo sapiens) [TaxId: 9606]}
ddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavc
ivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcp
Timeline for d3qq8a1: