Class b: All beta proteins [48724] (176 folds) |
Fold b.15: HSP20-like chaperones [49763] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) |
Family b.15.1.0: automated matches [191643] (1 protein) not a true family |
Protein automated matches [191181] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [233346] (1 PDB entry) |
Domain d3qorc_: 3qor C: [239641] automated match to d3qora_ complexed with act |
PDB Entry: 3qor (more details), 1.75 Å
SCOPe Domain Sequences for d3qorc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qorc_ b.15.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sklkpnlgngadlpnyrwtqtlseldlavpfcvnfrlkgkdmvvdiqrrhlrvglkgqpa iidgelynevkveesswliadgavvtvhlekinkmewwsrlvssdpeintkkinpen
Timeline for d3qorc_:
View in 3D Domains from other chains: (mouse over for more information) d3qora_, d3qorb_, d3qord_, d3qore_ |