Lineage for d3qorb_ (3qor B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776751Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1776752Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 1776847Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 1776848Protein automated matches [191181] (5 species)
    not a true protein
  7. 1776849Species Human (Homo sapiens) [TaxId:9606] [233346] (1 PDB entry)
  8. 1776851Domain d3qorb_: 3qor B: [239640]
    automated match to d3qora_
    complexed with act

Details for d3qorb_

PDB Entry: 3qor (more details), 1.75 Å

PDB Description: Crystal structure of human nuclear migration protein NudC
PDB Compounds: (B:) Nuclear migration protein nudC

SCOPe Domain Sequences for d3qorb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qorb_ b.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sssklkpnlgngadlpnyrwtqtlseldlavpfcvnfrlkgkdmvvdiqrrhlrvglkgq
paiidgelynevkveesswliadgavvtvhlekinkmewwsrlvssdpeintkkinpen

SCOPe Domain Coordinates for d3qorb_:

Click to download the PDB-style file with coordinates for d3qorb_.
(The format of our PDB-style files is described here.)

Timeline for d3qorb_: