![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) ![]() |
![]() | Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins) |
![]() | Protein automated matches [254525] (2 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [256027] (1 PDB entry) |
![]() | Domain d3pz4a_: 3pz4 A: [239631] Other proteins in same PDB: d3pz4b_ automated match to d1d8da_ complexed with 3pz, fpp, zn |
PDB Entry: 3pz4 (more details), 2.1 Å
SCOPe Domain Sequences for d3pz4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pz4a_ a.118.6.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke ywryigrslqskhsr
Timeline for d3pz4a_: