Lineage for d3phtb_ (3pht B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954274Family d.58.18.0: automated matches [227175] (1 protein)
    not a true family
  6. 2954275Protein automated matches [226892] (5 species)
    not a true protein
  7. 2954281Species Helicobacter pylori [TaxId:210] [233241] (1 PDB entry)
  8. 2954283Domain d3phtb_: 3pht B: [239621]
    Other proteins in same PDB: d3phta1
    automated match to d3phta2
    complexed with ni; mutant

Details for d3phtb_

PDB Entry: 3pht (more details), 2.04 Å

PDB Description: Crystal structure of H74A mutant of Helicobacter Pylori NikR
PDB Compounds: (B:) putative nickel-responsive regulator

SCOPe Domain Sequences for d3phtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3phtb_ d.58.18.0 (B:) automated matches {Helicobacter pylori [TaxId: 210]}
ndeskiavlvviydahqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfe
iqrlqleigglrgvkfakltka

SCOPe Domain Coordinates for d3phtb_:

Click to download the PDB-style file with coordinates for d3phtb_.
(The format of our PDB-style files is described here.)

Timeline for d3phtb_: