| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
| Family d.58.18.0: automated matches [227175] (1 protein) not a true family |
| Protein automated matches [226892] (5 species) not a true protein |
| Species Helicobacter pylori [TaxId:210] [233241] (1 PDB entry) |
| Domain d3phtb_: 3pht B: [239621] Other proteins in same PDB: d3phta1 automated match to d3phta2 complexed with ni; mutant |
PDB Entry: 3pht (more details), 2.04 Å
SCOPe Domain Sequences for d3phtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3phtb_ d.58.18.0 (B:) automated matches {Helicobacter pylori [TaxId: 210]}
ndeskiavlvviydahqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfe
iqrlqleigglrgvkfakltka
Timeline for d3phtb_: