Lineage for d1apnb_ (1apn B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12396Protein Concanavalin A [49901] (2 species)
  7. 12402Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (38 PDB entries)
  8. 12437Domain d1apnb_: 1apn B: [23962]

Details for d1apnb_

PDB Entry: 1apn (more details), 2.5 Å

PDB Description: the crystallographic structure of metal-free concanavalin a at 2.5 angstroms resolution

SCOP Domain Sequences for d1apnb_:

Sequence, based on SEQRES records: (download)

>d1apnb_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis)}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d1apnb_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis)}
adtivaveldtypnsyphigidiksvrskktakwnmqngkvgtahiiynsvdkrlsavvs
ypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsthetnal
hfmfnqfskdqkdlilqgdattgtdgnleltrvqgssvgralfyapvhiwessavvasfe
atftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOP Domain Coordinates for d1apnb_:

Click to download the PDB-style file with coordinates for d1apnb_.
(The format of our PDB-style files is described here.)

Timeline for d1apnb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1apna_